PDB entry 4m53

View 4m53 on RCSB PDB site
Description: Gamma subunit of the translation initiation factor 2 from Sulfolobus solfataricus in complex with GDPCP
Class: translation
Keywords: aIF2, aIF2 gamma subunit, G-protein, translation, translation initiation, protein biosynthesis, RNA-binding, GTP-binding, nucleotide-binding
Deposited on 2013-08-07, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 subunit gamma
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Gene: eif2g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m53a1, d4m53a2, d4m53a3
  • Heterogens: BME, FMT, GCP, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m53A (A:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskklgyaetnigvcesckkpeayvte
    psckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtre
    hfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkini
    dsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdq
    eikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnl
    lgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivt
    svkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m53A (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskklgyaetnigvcesckkpeayvtep
    sckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtreh
    fvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkinid
    sliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqe
    ikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnll
    gsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivts
    vkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei