SCOPe 2.07: Domain d4lsoa_: 4lso A:

Lineage for d4lsoa_ (4lso A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (33 species)
   not a true protein

7. Species Bartonella quintana [TaxId:1134506] [256360] (1 PDB entry)

8. Domain d4lsoa_: 4lso A: [253685]
   automated match to d2bhma1

Details for d4lsoa_

PDB Entry: 4lso, 1.7 Å

PDB Description: crystal structure of the soluble domain of a type iv secretion system protein virb8 from bartonella quintana toulouse

PDB Compounds: (A:) type IV secretion system protein virb8

SCOPe Domain Sequences for d4lsoa_:

Sequence; same for both SEQRES and ATOM records:

>d4lsoa_ d.17.4.0 (A:) automated matches {Bartonella quintana [TaxId: 1134506]}
pnnydeaitryfaskyvraregfqlseaeynfrlisllsspeeqnrfakwysgnnpespq
niyhnmtakvtiksisflskdliqvryyktirelngkenishwvsilnfsyinahisted
rlinplgfqvseyrsdpevik

Timeline for d4lsoa_:

• d4lsoa_ first appeared in SCOPe 2.04
  
• d4lsoa_ appears in SCOPe 2.06
  
• d4lsoa_ appears in the current release, SCOPe 2.08