PDB entry 4lso

View 4lso on RCSB PDB site
Description: Crystal structure of the soluble domain of a Type IV secretion system protein VirB8 from Bartonella quintana Toulouse
Class: protein transport
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, dimer-monomer analysis, type IV secretion system, innate response, human pathogen, host specific protein, cell adhesion, PROTEIN TRANSPORT
Deposited on 2013-07-22, released 2014-03-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type IV secretion system protein virb8
    Species: Bartonella quintana [TaxId:1134506]
    Gene: BQ10590, virB8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FYW3 (Start-178)
      • variant (51)
    Domains in SCOPe 2.07: d4lsoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lsoA (A:)
    mahhhhhhmtplktvepfvirvdnstgiietvsalketpnnydeaitryfaskyvrareg
    fqlseaeynfrlisllsspeeqnrfakwysgnnpespqniyhnmtakvtiksisflskdl
    iqvryyktirelngkenishwvsilnfsyinahistedrlinplgfqvseyrsdpevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lsoA (A:)
    pnnydeaitryfaskyvraregfqlseaeynfrlisllsspeeqnrfakwysgnnpespq
    niyhnmtakvtiksisflskdliqvryyktirelngkenishwvsilnfsyinahisted
    rlinplgfqvseyrsdpevik