Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (19 species) not a true protein |
Species Bartonella quintana [TaxId:1134506] [256360] (1 PDB entry) |
Domain d4lsoa_: 4lso A: [253685] automated match to d2bhma1 |
PDB Entry: 4lso (more details), 1.7 Å
SCOPe Domain Sequences for d4lsoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lsoa_ d.17.4.0 (A:) automated matches {Bartonella quintana [TaxId: 1134506]} pnnydeaitryfaskyvraregfqlseaeynfrlisllsspeeqnrfakwysgnnpespq niyhnmtakvtiksisflskdliqvryyktirelngkenishwvsilnfsyinahisted rlinplgfqvseyrsdpevik
Timeline for d4lsoa_: