Lineage for d4lsoa_ (4lso A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641515Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1641516Protein automated matches [190205] (19 species)
    not a true protein
  7. 1641530Species Bartonella quintana [TaxId:1134506] [256360] (1 PDB entry)
  8. 1641531Domain d4lsoa_: 4lso A: [253685]
    automated match to d2bhma1

Details for d4lsoa_

PDB Entry: 4lso (more details), 1.7 Å

PDB Description: crystal structure of the soluble domain of a type iv secretion system protein virb8 from bartonella quintana toulouse
PDB Compounds: (A:) type IV secretion system protein virb8

SCOPe Domain Sequences for d4lsoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lsoa_ d.17.4.0 (A:) automated matches {Bartonella quintana [TaxId: 1134506]}
pnnydeaitryfaskyvraregfqlseaeynfrlisllsspeeqnrfakwysgnnpespq
niyhnmtakvtiksisflskdliqvryyktirelngkenishwvsilnfsyinahisted
rlinplgfqvseyrsdpevik

SCOPe Domain Coordinates for d4lsoa_:

Click to download the PDB-style file with coordinates for d4lsoa_.
(The format of our PDB-style files is described here.)

Timeline for d4lsoa_: