SCOPe 2.06: Domain d4kasc1: 4kas C:1-220

Lineage for d4kasc1 (4kas C:1-220)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
   complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354

4. Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families)
   automatically mapped to Pfam PF02511

5. Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)

6. Protein Thy1 homologue [69798] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [69799] (25 PDB entries)
   TM0449

8. Domain d4kasc1: 4kas C:1-220 [253226]
   Other proteins in same PDB: d4kasa2, d4kasb2, d4kasc2
   automated match to d4karb_
   complexed with 2pe, cl, du, fad, po4, so4; mutant

Details for d4kasc1

PDB Entry: 4kas, 1.85 Å

PDB Description: Crystal structure of FDTS from T. maritima mutant (H53D) with FAD and dUMP

PDB Compounds: (C:) Thymidylate synthase thyX

SCOPe Domain Sequences for d4kasc1:

Sequence, based on SEQRES records:

>d4kasc1 d.207.1.1 (C:1-220) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhgdetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv

Sequence, based on observed residues (ATOM records):

>d4kasc1 d.207.1.1 (C:1-220) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdkdeerdrhlieylmkhgdetpfehivft
fhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervtekis
eivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaqwei
qqyalaiarifkekcpwtfeaflkyaykgdilkevqv

Timeline for d4kasc1:

• d4kasc1 first appeared in SCOPe 2.04, called d4kasc_
  
• d4kasc1 was called d4kasc_ in SCOPe 2.05
  
• d4kasc1 appears in SCOPe 2.07
  
• d4kasc1 appears in the current release, SCOPe 2.08