Lineage for d4kasc1 (4kas C:1-220)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612201Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 2612202Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families) (S)
    automatically mapped to Pfam PF02511
  5. 2612203Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 2612204Protein Thy1 homologue [69798] (1 species)
  7. 2612205Species Thermotoga maritima [TaxId:2336] [69799] (28 PDB entries)
    TM0449
  8. 2612228Domain d4kasc1: 4kas C:1-220 [253226]
    Other proteins in same PDB: d4kasa2, d4kasb2, d4kasc2
    automated match to d4karb_
    complexed with 2pe, cl, du, fad, po4, so4; mutant

Details for d4kasc1

PDB Entry: 4kas (more details), 1.85 Å

PDB Description: Crystal structure of FDTS from T. maritima mutant (H53D) with FAD and dUMP
PDB Compounds: (C:) Thymidylate synthase thyX

SCOPe Domain Sequences for d4kasc1:

Sequence, based on SEQRES records: (download)

>d4kasc1 d.207.1.1 (C:1-220) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhgdetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv

Sequence, based on observed residues (ATOM records): (download)

>d4kasc1 d.207.1.1 (C:1-220) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdkdeerdrhlieylmkhgdetpfehivft
fhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervtekis
eivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaqwei
qqyalaiarifkekcpwtfeaflkyaykgdilkevqv

SCOPe Domain Coordinates for d4kasc1:

Click to download the PDB-style file with coordinates for d4kasc1.
(The format of our PDB-style files is described here.)

Timeline for d4kasc1: