Lineage for d4kasd_ (4kas D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238756Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 2238757Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families) (S)
    automatically mapped to Pfam PF02511
  5. 2238758Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 2238759Protein Thy1 homologue [69798] (1 species)
  7. 2238760Species Thermotoga maritima [TaxId:2336] [69799] (25 PDB entries)
    TM0449
  8. 2238796Domain d4kasd_: 4kas D: [253227]
    Other proteins in same PDB: d4kasa2, d4kasb2, d4kasc2
    automated match to d4karb_
    complexed with 2pe, cl, du, fad, po4, so4; mutant

Details for d4kasd_

PDB Entry: 4kas (more details), 1.85 Å

PDB Description: Crystal structure of FDTS from T. maritima mutant (H53D) with FAD and dUMP
PDB Compounds: (D:) Thymidylate synthase thyX

SCOPe Domain Sequences for d4kasd_:

Sequence, based on SEQRES records: (download)

>d4kasd_ d.207.1.1 (D:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhgdetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilke

Sequence, based on observed residues (ATOM records): (download)

>d4kasd_ d.207.1.1 (D:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdkdeerdrhlieylmkhgdetpfehivft
fhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervtekis
eivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaqwei
qqyalaiarifkekcpwtfeaflkyaykgdilke

SCOPe Domain Coordinates for d4kasd_:

Click to download the PDB-style file with coordinates for d4kasd_.
(The format of our PDB-style files is described here.)

Timeline for d4kasd_: