Lineage for d1mjc__ (1mjc -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14165Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins)
  6. 14172Protein Major cold shock protein [50283] (3 species)
  7. 14181Species Escherichia coli [TaxId:562] [50284] (2 PDB entries)
  8. 14182Domain d1mjc__: 1mjc - [25319]

Details for d1mjc__

PDB Entry: 1mjc (more details), 2 Å

PDB Description: crystal structure of cspa, the major cold shock protein of escherichia coli

SCOP Domain Sequences for d1mjc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjc__ b.40.4.5 (-) Major cold shock protein {Escherichia coli}
sgkmtgivkwfnadkgfgfitpddgskdvfvhfsaiqndgyksldegqkvsftiesgakg
paagnvtsl

SCOP Domain Coordinates for d1mjc__:

Click to download the PDB-style file with coordinates for d1mjc__.
(The format of our PDB-style files is described here.)

Timeline for d1mjc__: