Lineage for d1ewia_ (1ewi A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789427Protein Replication protein A 70 KDa subunit (RPA70) [50267] (1 species)
    duplication: consists of three domains of this fold; contains zinc-finger insert in the C-terminal domain, residues 479-511
  7. 2789428Species Human (Homo sapiens) [TaxId:9606] [50268] (4 PDB entries)
  8. 2789437Domain d1ewia_: 1ewi A: [25302]
    N-terminal domain only

Details for d1ewia_

PDB Entry: 1ewi (more details)

PDB Description: human replication protein a: global fold of the n-terminal rpa-70 domain reveals a basic cleft and flexible c-terminal linker
PDB Compounds: (A:) replication protein a

SCOPe Domain Sequences for d1ewia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewia_ b.40.4.3 (A:) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]}
mvgqlsegaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkign

SCOPe Domain Coordinates for d1ewia_:

Click to download the PDB-style file with coordinates for d1ewia_.
(The format of our PDB-style files is described here.)

Timeline for d1ewia_: