PDB entry 1ewi

View 1ewi on RCSB PDB site
Description: human replication protein a: global fold of the n-terminal rpa-70 domain reveals a basic cleft and flexible c-terminal linker
Class: replication
Keywords: 5-stranded anti-parallel, beta barrel, REPLICATION
Deposited on 2000-04-25, released 2000-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: replication protein a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ewia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewiA (A:)
    mvgqlsegaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
    qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkign