Lineage for d1ewia_ (1ewi A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14109Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)
  6. 14121Protein Replication protein A 70 KDa subunit (RPA70) fragment [50267] (1 species)
  7. 14122Species Human (Homo sapiens) [TaxId:9606] [50268] (3 PDB entries)
  8. 14129Domain d1ewia_: 1ewi A: [25302]

Details for d1ewia_

PDB Entry: 1ewi (more details)

PDB Description: human replication protein a: global fold of the n-terminal rpa-70 domain reveals a basic cleft and flexible c-terminal linker

SCOP Domain Sequences for d1ewia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewia_ b.40.4.3 (A:) Replication protein A 70 KDa subunit (RPA70) fragment {Human (Homo sapiens)}
mvgqlsegaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkign

SCOP Domain Coordinates for d1ewia_:

Click to download the PDB-style file with coordinates for d1ewia_.
(The format of our PDB-style files is described here.)

Timeline for d1ewia_: