Lineage for d4jfgg_ (4jfg G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2939778Protein Green fluorescent protein, GFP [54513] (6 species)
  7. 2939786Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
    Uniprot P42212
  8. 2940172Domain d4jfgg_: 4jfg G: [252927]
    Other proteins in same PDB: d4jfga2, d4jfge2
    automated match to d3ztfa_
    complexed with cs, hqy

Details for d4jfgg_

PDB Entry: 4jfg (more details), 3 Å

PDB Description: Crystal structure of sfGFP-66-HqAla
PDB Compounds: (G:) Green fluorescent protein

SCOPe Domain Sequences for d4jfgg_:

Sequence, based on SEQRES records: (download)

>d4jfgg_ d.22.1.1 (G:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
geelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvtt
lxvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnriel
kgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyqqn
tpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaag

Sequence, based on observed residues (ATOM records): (download)

>d4jfgg_ d.22.1.1 (G:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
geelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvtt
lxvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnriel
kgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyqqn
tpigdgpvlpdnhylstqsvlskdpnekrdhmvllefvtaag

SCOPe Domain Coordinates for d4jfgg_:

Click to download the PDB-style file with coordinates for d4jfgg_.
(The format of our PDB-style files is described here.)

Timeline for d4jfgg_: