Lineage for d4jfgf_ (4jfg F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2508389Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2508393Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2508399Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (203 PDB entries)
    Uniprot P42212
  8. 2508670Domain d4jfgf_: 4jfg F: [252926]
    Other proteins in same PDB: d4jfga2, d4jfge2
    automated match to d3ztfa_
    complexed with cs, hqy

Details for d4jfgf_

PDB Entry: 4jfg (more details), 3 Å

PDB Description: Crystal structure of sfGFP-66-HqAla
PDB Compounds: (F:) Green fluorescent protein

SCOPe Domain Sequences for d4jfgf_:

Sequence, based on SEQRES records: (download)

>d4jfgf_ d.22.1.1 (F:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
eelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvttl
xvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnrielk
gidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyqqnt
pigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaa

Sequence, based on observed residues (ATOM records): (download)

>d4jfgf_ d.22.1.1 (F:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
eelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvttl
xvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnrielk
gidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyqqnt
pigdgppdnhylstqsvlskdpnekrdhmvllefvtaa

SCOPe Domain Coordinates for d4jfgf_:

Click to download the PDB-style file with coordinates for d4jfgf_.
(The format of our PDB-style files is described here.)

Timeline for d4jfgf_: