![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) ![]() |
![]() | Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins) |
![]() | Protein automated matches [254752] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [256327] (1 PDB entry) |
![]() | Domain d4jd2d2: 4jd2 D:121-283 [252894] Other proteins in same PDB: d4jd2a1, d4jd2a2, d4jd2c_, d4jd2e_, d4jd2f_, d4jd2g_, d4jd2h_ automated match to d1k8kd2 complexed with atp, ca, pg4 |
PDB Entry: 4jd2 (more details), 3.08 Å
SCOPe Domain Sequences for d4jd2d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jd2d2 d.198.2.1 (D:121-283) automated matches {Cow (Bos taurus) [TaxId: 9913]} fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpd
Timeline for d4jd2d2: