Lineage for d4jd2d2 (4jd2 D:121-283)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005912Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 3006006Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 3006007Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)
  6. 3006061Protein automated matches [254752] (1 species)
    not a true protein
  7. 3006062Species Cow (Bos taurus) [TaxId:9913] [256327] (1 PDB entry)
  8. 3006064Domain d4jd2d2: 4jd2 D:121-283 [252894]
    Other proteins in same PDB: d4jd2a1, d4jd2a2, d4jd2c_, d4jd2e_, d4jd2f_, d4jd2g_, d4jd2h_
    automated match to d1k8kd2
    complexed with atp, ca, pg4

Details for d4jd2d2

PDB Entry: 4jd2 (more details), 3.08 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex binding with Mus musculus GMF
PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOPe Domain Sequences for d4jd2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jd2d2 d.198.2.1 (D:121-283) automated matches {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpd

SCOPe Domain Coordinates for d4jd2d2:

Click to download the PDB-style file with coordinates for d4jd2d2.
(The format of our PDB-style files is described here.)

Timeline for d4jd2d2: