Lineage for d4jd2a2 (4jd2 A:161-416)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2122052Family c.55.1.1: Actin/HSP70 [53068] (8 protein domains)
  6. 2122439Protein automated matches [226905] (13 species)
    not a true protein
  7. 2122444Species Cow (Bos taurus) [TaxId:9913] [225259] (3 PDB entries)
  8. 2122446Domain d4jd2a2: 4jd2 A:161-416 [252891]
    Other proteins in same PDB: d4jd2a1, d4jd2c_, d4jd2d1, d4jd2d2, d4jd2e_, d4jd2f_, d4jd2g_, d4jd2h_
    automated match to d1k8ka2
    complexed with atp, ca, pg4

Details for d4jd2a2

PDB Entry: 4jd2 (more details), 3.08 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex binding with Mus musculus GMF
PDB Compounds: (A:) Actin-related protein 3

SCOPe Domain Sequences for d4jd2a2:

Sequence, based on SEQRES records: (download)

>d4jd2a2 c.55.1.1 (A:161-416) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs
letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe
iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk
rtvdarlklseelsggrlkpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdy
eeigpsicrhnpvfgv

Sequence, based on observed residues (ATOM records): (download)

>d4jd2a2 c.55.1.1 (A:161-416) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs
letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe
iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk
rtvdarlklseelsgpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeig
psicrhnpvfgv

SCOPe Domain Coordinates for d4jd2a2:

Click to download the PDB-style file with coordinates for d4jd2a2.
(The format of our PDB-style files is described here.)

Timeline for d4jd2a2: