Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226802] (3 PDB entries) |
Domain d4jd2a1: 4jd2 A:3-160 [252890] Other proteins in same PDB: d4jd2a2, d4jd2c_, d4jd2d1, d4jd2d2, d4jd2e_, d4jd2f_, d4jd2g_, d4jd2h_ automated match to d1k8ka1 complexed with atp, ca, pg4 |
PDB Entry: 4jd2 (more details), 3.08 Å
SCOPe Domain Sequences for d4jd2a1:
Sequence, based on SEQRES records: (download)
>d4jd2a1 c.55.1.0 (A:3-160) automated matches {Cow (Bos taurus) [TaxId: 9913]} grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen reytaeimfesfnvpglyiavqavlalaaswtsrqvge
>d4jd2a1 c.55.1.0 (A:3-160) automated matches {Cow (Bos taurus) [TaxId: 9913]} grlpacvvdcgtgytklgyagntepqfiipsciaikemkgvddldffigdeaiekptyat kwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfesf nvpglyiavqavlalaaswtsrqvge
Timeline for d4jd2a1: