Lineage for d4jd2a1 (4jd2 A:3-160)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2884963Species Cow (Bos taurus) [TaxId:9913] [226802] (3 PDB entries)
  8. 2884965Domain d4jd2a1: 4jd2 A:3-160 [252890]
    Other proteins in same PDB: d4jd2a2, d4jd2c_, d4jd2d1, d4jd2d2, d4jd2e_, d4jd2f_, d4jd2g_, d4jd2h_
    automated match to d1k8ka1
    complexed with atp, ca, pg4

Details for d4jd2a1

PDB Entry: 4jd2 (more details), 3.08 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex binding with Mus musculus GMF
PDB Compounds: (A:) Actin-related protein 3

SCOPe Domain Sequences for d4jd2a1:

Sequence, based on SEQRES records: (download)

>d4jd2a1 c.55.1.0 (A:3-160) automated matches {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi
gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen
reytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records): (download)

>d4jd2a1 c.55.1.0 (A:3-160) automated matches {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikemkgvddldffigdeaiekptyat
kwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfesf
nvpglyiavqavlalaaswtsrqvge

SCOPe Domain Coordinates for d4jd2a1:

Click to download the PDB-style file with coordinates for d4jd2a1.
(The format of our PDB-style files is described here.)

Timeline for d4jd2a1: