Class a: All alpha proteins [46456] (290 folds) |
Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) automatically mapped to Pfam PF04062 |
Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins) |
Protein automated matches [190347] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187174] (12 PDB entries) |
Domain d4jd2e_: 4jd2 E: [252895] Other proteins in same PDB: d4jd2a1, d4jd2a2, d4jd2c_, d4jd2d1, d4jd2d2, d4jd2f_, d4jd2g_, d4jd2h_ automated match to d1k8ke_ complexed with atp, ca, pg4 |
PDB Entry: 4jd2 (more details), 3.08 Å
SCOPe Domain Sequences for d4jd2e_:
Sequence, based on SEQRES records: (download)
>d4jd2e_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls
>d4jd2e_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpaprekdtdivdeaiyyfkanvffknyeikn eadrtliyitlyiseclkklqkcnsksqgekemytlgitfpipgepgfplnaiyakpnkq edevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls
Timeline for d4jd2e_: