Lineage for d4jd2c_ (4jd2 C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2065972Family b.69.4.1: WD40-repeat [50979] (13 protein domains)
  6. 2066073Protein automated matches [190346] (4 species)
    not a true protein
  7. 2066074Species Cow (Bos taurus) [TaxId:9913] [187173] (14 PDB entries)
  8. 2066083Domain d4jd2c_: 4jd2 C: [252892]
    Other proteins in same PDB: d4jd2a1, d4jd2a2, d4jd2d1, d4jd2d2, d4jd2e_, d4jd2f_, d4jd2g_, d4jd2h_
    automated match to d1tyqc_
    complexed with atp, ca, pg4

Details for d4jd2c_

PDB Entry: 4jd2 (more details), 3.08 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex binding with Mus musculus GMF
PDB Compounds: (C:) Actin-related protein 2/3 complex subunit 1B

SCOPe Domain Sequences for d4jd2c_:

Sequence, based on SEQRES records: (download)

>d4jd2c_ b.69.4.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgidw
apdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvi
sicyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerp
aptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatl
asetlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltare
rfqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvr
slesalkdlkiv

Sequence, based on observed residues (ATOM records): (download)

>d4jd2c_ b.69.4.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgidw
apdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvi
sicyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerp
aptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatl
asetlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpagldslhknsvs
qisvlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv

SCOPe Domain Coordinates for d4jd2c_:

Click to download the PDB-style file with coordinates for d4jd2c_.
(The format of our PDB-style files is described here.)

Timeline for d4jd2c_: