Lineage for d4jd2e_ (4jd2 E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751838Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 1751839Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
    automatically mapped to Pfam PF04062
  5. 1751840Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)
  6. 1751848Protein automated matches [190347] (1 species)
    not a true protein
  7. 1751849Species Cow (Bos taurus) [TaxId:9913] [187174] (12 PDB entries)
  8. 1751856Domain d4jd2e_: 4jd2 E: [252895]
    Other proteins in same PDB: d4jd2a1, d4jd2a2, d4jd2c_, d4jd2d1, d4jd2d2, d4jd2f_, d4jd2g_, d4jd2h_
    automated match to d1k8ke_
    complexed with atp, ca, pg4

Details for d4jd2e_

PDB Entry: 4jd2 (more details), 3.08 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex binding with Mus musculus GMF
PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOPe Domain Sequences for d4jd2e_:

Sequence, based on SEQRES records: (download)

>d4jd2e_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls

Sequence, based on observed residues (ATOM records): (download)

>d4jd2e_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpaprekdtdivdeaiyyfkanvffknyeikn
eadrtliyitlyiseclkklqkcnsksqgekemytlgitfpipgepgfplnaiyakpnkq
edevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls

SCOPe Domain Coordinates for d4jd2e_:

Click to download the PDB-style file with coordinates for d4jd2e_.
(The format of our PDB-style files is described here.)

Timeline for d4jd2e_: