SCOPe 2.05: Domain d4jd2a1: 4jd2 A:3-160

Lineage for d4jd2a1 (4jd2 A:3-160)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226802] (3 PDB entries)

8. Domain d4jd2a1: 4jd2 A:3-160 [252890]
   Other proteins in same PDB: d4jd2a2, d4jd2c_, d4jd2d1, d4jd2d2, d4jd2e_, d4jd2f_, d4jd2g_, d4jd2h_
   automated match to d1k8ka1
   complexed with atp, ca, pg4

Details for d4jd2a1

PDB Entry: 4jd2, 3.08 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex binding with Mus musculus GMF

PDB Compounds: (A:) Actin-related protein 3

SCOPe Domain Sequences for d4jd2a1:

Sequence, based on SEQRES records:

>d4jd2a1 c.55.1.0 (A:3-160) automated matches {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi
gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen
reytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records):

>d4jd2a1 c.55.1.0 (A:3-160) automated matches {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikemkgvddldffigdeaiekptyat
kwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfesf
nvpglyiavqavlalaaswtsrqvge

Timeline for d4jd2a1:

• d4jd2a1 first appeared in SCOPe 2.04
  
• d4jd2a1 appears in SCOPe 2.06
  
• d4jd2a1 appears in the current release, SCOPe 2.08