Lineage for d4jd2f_ (4jd2 F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1943975Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1944058Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1944059Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)
  6. 1944094Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 1944095Species Cow (Bos taurus) [TaxId:9913] [69648] (17 PDB entries)
    Uniprot P59998 # 100% sequence identity
  8. 1944107Domain d4jd2f_: 4jd2 F: [252896]
    Other proteins in same PDB: d4jd2a1, d4jd2a2, d4jd2c_, d4jd2d1, d4jd2d2, d4jd2e_, d4jd2g_, d4jd2h_
    automated match to d1k8kf_
    complexed with atp, ca, pg4

Details for d4jd2f_

PDB Entry: 4jd2 (more details), 3.08 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex binding with Mus musculus GMF
PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOPe Domain Sequences for d4jd2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jd2f_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl
iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh
teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOPe Domain Coordinates for d4jd2f_:

Click to download the PDB-style file with coordinates for d4jd2f_.
(The format of our PDB-style files is described here.)

Timeline for d4jd2f_: