Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) barrel, closed; n=5, S=10 |
Protein Lysyl-tRNA synthetase (LysRS) [50256] (3 species) |
Species Escherichia coli, gene lysU [TaxId:562] [50258] (5 PDB entries) |
Domain d1e24a1: 1e24 A:11-153 [25260] Other proteins in same PDB: d1e24a2 protein/RNA complex; complexed with atp, gol, lys, mn |
PDB Entry: 1e24 (more details), 2.35 Å
SCOPe Domain Sequences for d1e24a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e24a1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} aidfndelrnrreklaalrqqgvafpndfrrdhtsdqlheefdakdnqeleslnievsva grmmtrrimgkasfvtlqdvggriqlyvardslpegvyndqfkkwdlgdiigargtlfkt qtgelsihctelrlltkalrplp
Timeline for d1e24a1: