PDB entry 1e24

View 1e24 on RCSB PDB site
Description: lysyl-tRNA synthetase (lysu) hexagonal form complexed with lysine and ATP and mn2+
Class: ligase
Keywords: ligase, aminoacyl-tRNA synthetase, protein biosynthesis
Deposited on 2000-05-16, released 2000-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.249
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysyl-tRNA synthetase
    Species: Escherichia coli [TaxId:83333]
    Gene: LYSU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e24a1, d1e24a2
  • Heterogens: LYS, ATP, MN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e24A (A:)
    seqetrganeaidfndelrnrreklaalrqqgvafpndfrrdhtsdqlheefdakdnqel
    eslnievsvagrmmtrrimgkasfvtlqdvggriqlyvardslpegvyndqfkkwdlgdi
    igargtlfktqtgelsihctelrlltkalrplpdkfhglqdqevryrqryldliandksr
    qtfvvrskilaairqfmvargfmevetpmmqvipggasarpfithhnaldldmylriape
    lylkrlvvggfervfeinrnfrnegisvrhnpeftmmelymayadyhdlielteslfrtl
    aqevlgttkvtygehvfdfgkpfekltmreaikkyrpetdmadldnfdaakalaesigit
    vekswglgrivteifdevaeahliqptfiteypaevsplarrndvnpeitdrfeffiggr
    eigngfselndaedqaerfqeqvnakaagddeamfydedyvtaleyglpptaglgigidr
    mimlftnshtirdvilfpamrpqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e24A (A:)
    aidfndelrnrreklaalrqqgvafpndfrrdhtsdqlheefdakdnqeleslnievsva
    grmmtrrimgkasfvtlqdvggriqlyvardslpegvyndqfkkwdlgdiigargtlfkt
    qtgelsihctelrlltkalrplpdqevryrqryldliandksrqtfvvrskilaairqfm
    vargfmevetpmmqvipggasarpfithhnaldldmylriapelylkrlvvggfervfei
    nrnfrnegisvrhnpeftmmelymayadyhdlielteslfrtlaqevlgttkvtygehvf
    dfgkpfekltmreaikkyrpetdmadldnfdaakalaesigitvekswglgrivteifde
    vaeahliqptfiteypaevsplarrndvnpeitdrfeffiggreigngfselndaedqae
    rfqeqvnakaagddeamfydedyvtaleyglpptaglgigidrmimlftnshtirdvilf
    pamrp