Lineage for d1e24a1 (1e24 A:11-153)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) 
Protein Lysyl-tRNA synthetase (LysRS) [50256] (2 species) Species Escherichia coli, gene lysU [TaxId:562] [50258] (5 PDB entries) 
Domain d1e24a1: 1e24 A:11-153 [25260]
Other proteins in same PDB: d1e24a2
Details for d1e24a1
PDB Entry: 1e24 (more details), 2.35 Å
PDB Description: lysyl-trna synthetase (lysu) hexagonal form complexed with lysine and atp and mn2+
SCOP Domain Sequences for d1e24a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e24a1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU}
aidfndelrnrreklaalrqqgvafpndfrrdhtsdqlheefdakdnqeleslnievsva
grmmtrrimgkasfvtlqdvggriqlyvardslpegvyndqfkkwdlgdiigargtlfkt
qtgelsihctelrlltkalrplp
SCOP Domain Coordinates for d1e24a1:
Click to download the PDB-style file with coordinates for d1e24a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e24a1:
- d1e24a1 appears in SCOP 1.57
- d1e24a1 appears in the current release, SCOPe 2.08
View in 3D
