Lineage for d4hv4a3 (4hv4 A:323-483)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890898Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 2890899Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 2890942Family c.59.1.0: automated matches [254241] (1 protein)
    not a true family
  6. 2890943Protein automated matches [254550] (5 species)
    not a true protein
  7. 2890962Species Yersinia pestis [TaxId:214092] [256292] (1 PDB entry)
  8. 2890963Domain d4hv4a3: 4hv4 A:323-483 [252520]
    Other proteins in same PDB: d4hv4a1, d4hv4a2, d4hv4b1, d4hv4b2
    automated match to d1gqya2
    complexed with amp, bme

Details for d4hv4a3

PDB Entry: 4hv4 (more details), 2.25 Å

PDB Description: 2.25 angstrom resolution crystal structure of udp-n-acetylmuramate--l- alanine ligase (murc) from yersinia pestis co92 in complex with amp
PDB Compounds: (A:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d4hv4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hv4a3 c.59.1.0 (A:323-483) automated matches {Yersinia pestis [TaxId: 214092]}
gtgrrfdflgnfplapvngkegsamlvddyghhptevdatikaaragwpdkrivmlfqph
rytrtrdlyddfanvlsqvdvllmldvyaageppipgadsralcrtirnrgkldpilvpd
sesapemlaqilngedlilvqgagnigkiarklaehklqpq

SCOPe Domain Coordinates for d4hv4a3:

Click to download the PDB-style file with coordinates for d4hv4a3.
(The format of our PDB-style files is described here.)

Timeline for d4hv4a3: