Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) has extra strand located between strands 1 and 2 |
Family c.72.2.0: automated matches [254328] (1 protein) not a true family |
Protein automated matches [254749] (4 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [256291] (1 PDB entry) |
Domain d4hv4b2: 4hv4 B:108-322 [252522] Other proteins in same PDB: d4hv4a1, d4hv4a3, d4hv4b1, d4hv4b3 automated match to d1p3da3 complexed with amp, bme |
PDB Entry: 4hv4 (more details), 2.25 Å
SCOPe Domain Sequences for d4hv4b2:
Sequence, based on SEQRES records: (download)
>d4hv4b2 c.72.2.0 (B:108-322) automated matches {Yersinia pestis [TaxId: 214092]} raemlaelmryrhgiavagthgkttttamlssiyaeagldptfvngglvkaagtharlgs sryliaeadesdasflhlqpmvaivtnieadhmdtyqgdfenlkqtfinflhnlpfygra vmciddpvvrellprvgrhittygfsddadvqiasyrqegpqghftlrrqdkplievtln apgrhnalnaaaavavateegiededilralvgfq
>d4hv4b2 c.72.2.0 (B:108-322) automated matches {Yersinia pestis [TaxId: 214092]} raemlaelmryrhgiavagthgkttttamlssiyaeagldptfvngglvkaagtharlgs sryliaeadesdasflhlqpmvaivtnieaddfenlkqtfinflhnlpfygravmciddp vvrellprvgrhittygfsddadvqiasyrqegpqghftlrrqdkplievtlnapgrhna lnaaaavavateegiededilralvgfq
Timeline for d4hv4b2: