SCOPe 2.08: Domain d4hv4a1: 4hv4 A:19-107

Lineage for d4hv4a1 (4hv4 A:19-107)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group

4. Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families)

5. Family c.5.1.0: automated matches [254240] (1 protein)
   not a true family

6. Protein automated matches [254548] (7 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [256290] (1 PDB entry)

8. Domain d4hv4a1: 4hv4 A:19-107 [252518]
   Other proteins in same PDB: d4hv4a2, d4hv4a3, d4hv4b2, d4hv4b3
   automated match to d1gqqa1
   complexed with amp, bme

Details for d4hv4a1

PDB Entry: 4hv4, 2.25 Å

PDB Description: 2.25 angstrom resolution crystal structure of udp-n-acetylmuramate--l- alanine ligase (murc) from yersinia pestis co92 in complex with amp

PDB Compounds: (A:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d4hv4a1:

Sequence; same for both SEQRES and ATOM records:

>d4hv4a1 c.5.1.0 (A:19-107) automated matches {Yersinia pestis [TaxId: 214092]}
vrhihfvgiggagmggiaevlanegyqisgsdlapnsvtqhltalgaqiyfhhrpenvld
asvvvvstaisadnpeivaarearipvir

Timeline for d4hv4a1:

• d4hv4a1 first appeared in SCOPe 2.04
  
• d4hv4a1 appears in SCOPe 2.07