![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
![]() | Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) ![]() |
![]() | Family c.5.1.0: automated matches [254240] (1 protein) not a true family |
![]() | Protein automated matches [254548] (7 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [256290] (1 PDB entry) |
![]() | Domain d4hv4b1: 4hv4 B:15-107 [252521] Other proteins in same PDB: d4hv4a2, d4hv4a3, d4hv4b2, d4hv4b3 automated match to d1gqqa1 complexed with amp, bme |
PDB Entry: 4hv4 (more details), 2.25 Å
SCOPe Domain Sequences for d4hv4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hv4b1 c.5.1.0 (B:15-107) automated matches {Yersinia pestis [TaxId: 214092]} emrrvrhihfvgiggagmggiaevlanegyqisgsdlapnsvtqhltalgaqiyfhhrpe nvldasvvvvstaisadnpeivaarearipvir
Timeline for d4hv4b1: