Class a: All alpha proteins [46456] (285 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.5: TMV-like viral coat proteins [47195] (1 family) automatically mapped to Pfam PF00721 |
Family a.24.5.1: TMV-like viral coat proteins [47196] (4 proteins) |
Protein Tobacco mosaic virus coat protein [47197] (1 species) |
Species Tobacco mosaic virus, vulgare strain [TaxId:12242] [47198] (5 PDB entries) |
Domain d4gqhk_: 4gqh K: [252305] automated match to d2tmvp_ |
PDB Entry: 4gqh (more details), 3.06 Å
SCOPe Domain Sequences for d4gqhk_:
Sequence, based on SEQRES records: (download)
>d4gqhk_ a.24.5.1 (K:) Tobacco mosaic virus coat protein {Tobacco mosaic virus, vulgare strain [TaxId: 12242]} shsysittpsqfvflssawadpielinlctnalgnqfqtqqartvvqrqfsevwkpspqv tvrfpdsdfkvyrynavldplvtallgafdtrnriievenqanpttaetldatrrvddat vairsainnlivelirgtgsynrssfesssglvwts
>d4gqhk_ a.24.5.1 (K:) Tobacco mosaic virus coat protein {Tobacco mosaic virus, vulgare strain [TaxId: 12242]} shsysittpsqfvflssawadpielinlctnalgnqfqtqqartvvqrqfsevwkpspqv tvrfpdsdfkvyrynavldplvtallgafdtrnretldatrrvddatvairsainnlive lirgtgsynrssfesssglvwts
Timeline for d4gqhk_: