Class a: All alpha proteins [46456] (285 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.5: TMV-like viral coat proteins [47195] (1 family) automatically mapped to Pfam PF00721 |
Family a.24.5.1: TMV-like viral coat proteins [47196] (4 proteins) |
Protein Tobacco mosaic virus coat protein [47197] (1 species) |
Species Tobacco mosaic virus, vulgare strain [TaxId:12242] [47198] (5 PDB entries) |
Domain d4gqhe_: 4gqh E: [252299] automated match to d2tmvp_ |
PDB Entry: 4gqh (more details), 3.06 Å
SCOPe Domain Sequences for d4gqhe_:
Sequence, based on SEQRES records: (download)
>d4gqhe_ a.24.5.1 (E:) Tobacco mosaic virus coat protein {Tobacco mosaic virus, vulgare strain [TaxId: 12242]} gshsysittpsqfvflssawadpielinlctnalgnqfqtqqartvvqrqfsevwkpspq vtvrfpdsdfkvyrynavldplvtallgafdtrnriievenqanpttaetldatrrvdda tvairsainnlivelirgtgsynrssfesssglvwts
>d4gqhe_ a.24.5.1 (E:) Tobacco mosaic virus coat protein {Tobacco mosaic virus, vulgare strain [TaxId: 12242]} gshsysittpsqfvflssawadpielinlctnalgnqfqtqqartvvqrqfsevwkpspq vtvrfpdsdfkvyrynavldplvtallgafdtrndatrrvddatvairsainnlivelir gtgsynrssfesssglvwts
Timeline for d4gqhe_: