| Class b: All beta proteins [48724] (93 folds) |
| Fold b.40: OB-fold [50198] (7 superfamilies) |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
| Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species) |
| Species Shigella dysenteriae [TaxId:622] [50212] (2 PDB entries) |
| Domain d1dm0f_: 1dm0 F: [25110] Other proteins in same PDB: d1dm0a_, d1dm0l_ |
PDB Entry: 1dm0 (more details), 2.5 Å
SCOP Domain Sequences for d1dm0f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dm0f_ b.40.2.1 (F:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr
Timeline for d1dm0f_: