Lineage for d1dm0h_ (1dm0 H:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13633Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 13820Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species)
  7. 13913Species Shigella dysenteriae [TaxId:622] [50212] (2 PDB entries)
  8. 13925Domain d1dm0h_: 1dm0 H: [25112]
    Other proteins in same PDB: d1dm0a_, d1dm0l_

Details for d1dm0h_

PDB Entry: 1dm0 (more details), 2.5 Å

PDB Description: shiga toxin

SCOP Domain Sequences for d1dm0h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dm0h_ b.40.2.1 (H:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOP Domain Coordinates for d1dm0h_:

Click to download the PDB-style file with coordinates for d1dm0h_.
(The format of our PDB-style files is described here.)

Timeline for d1dm0h_: