Lineage for d3ztnb_ (3ztn B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970169Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)
  8. 1970203Domain d3ztnb_: 3ztn B: [250843]
    Other proteins in same PDB: d3ztna_, d3ztnl1
    automated match to d1rd8b_
    complexed with gol, nag, so4

Details for d3ztnb_

PDB Entry: 3ztn (more details), 3 Å

PDB Description: structure of influenza a neutralizing antibody selected from cultures of single human plasma cells in complex with human h1 influenza haemagglutinin.
PDB Compounds: (B:) Haemagglutinin

SCOPe Domain Sequences for d3ztnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ztnb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreei

SCOPe Domain Coordinates for d3ztnb_:

Click to download the PDB-style file with coordinates for d3ztnb_.
(The format of our PDB-style files is described here.)

Timeline for d3ztnb_: