SCOPe 2.06: Domain d3ztnb_: 3ztn B:

Lineage for d3ztnb_ (3ztn B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (34 species)
   not a true protein

7. Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)

8. Domain d3ztnb_: 3ztn B: [250843]
   Other proteins in same PDB: d3ztna_, d3ztnl1
   automated match to d1rd8b_
   complexed with gol, nag, so4

Details for d3ztnb_

PDB Entry: 3ztn, 3 Å

PDB Description: structure of influenza a neutralizing antibody selected from cultures of single human plasma cells in complex with human h1 influenza haemagglutinin.

PDB Compounds: (B:) Haemagglutinin

SCOPe Domain Sequences for d3ztnb_:

Sequence; same for both SEQRES and ATOM records:

>d3ztnb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreei

Timeline for d3ztnb_:

• d3ztnb_ first appeared in SCOPe 2.04
  
• d3ztnb_ appears in SCOPe 2.05
  
• d3ztnb_ appears in SCOPe 2.07
  
• d3ztnb_ appears in the current release, SCOPe 2.08