Lineage for d1rd8b_ (1rd8 B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969596Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)
  8. 1969878Domain d1rd8b_: 1rd8 B: [97309]
    Other proteins in same PDB: d1rd8a_, d1rd8c_, d1rd8e_
    1918 human H1
    complexed with nag, ndg, po4

Details for d1rd8b_

PDB Entry: 1rd8 (more details), 3 Å

PDB Description: crystal structure of the 1918 human h1 hemagglutinin precursor (ha0)
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d1rd8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rd8b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidg

SCOPe Domain Coordinates for d1rd8b_:

Click to download the PDB-style file with coordinates for d1rd8b_.
(The format of our PDB-style files is described here.)

Timeline for d1rd8b_: