SCOPe 2.05: Domain d3ztna_: 3ztn A:

Lineage for d3ztna_ (3ztn A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza A virus [TaxId:641501] [256167] (1 PDB entry)

8. Domain d3ztna_: 3ztn A: [250842]
   Other proteins in same PDB: d3ztnb_, d3ztnl1
   automated match to d1rd8a_
   complexed with gol, nag, so4

Details for d3ztna_

PDB Entry: 3ztn, 3 Å

PDB Description: structure of influenza a neutralizing antibody selected from cultures of single human plasma cells in complex with human h1 influenza haemagglutinin.

PDB Compounds: (A:) Haemagglutinin

SCOPe Domain Sequences for d3ztna_:

Sequence; same for both SEQRES and ATOM records:

>d3ztna_ b.19.1.2 (A:) automated matches {Influenza A virus [TaxId: 641501]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnipsiqsr

Timeline for d3ztna_:

• d3ztna_ first appeared in SCOPe 2.04
  
• d3ztna_ appears in SCOPe 2.06
  
• d3ztna_ appears in the current release, SCOPe 2.08