![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein automated matches [254646] (29 species) not a true protein |
![]() | Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries) |
![]() | Domain d3ztnb_: 3ztn B: [250843] Other proteins in same PDB: d3ztna_, d3ztnl1 automated match to d1rd8b_ complexed with gol, nag, so4 |
PDB Entry: 3ztn (more details), 3 Å
SCOPe Domain Sequences for d3ztnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ztnb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 641501]} glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreei
Timeline for d3ztnb_: