![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
![]() | Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
![]() | Family a.143.1.2: RPB6 [55294] (2 proteins) |
![]() | Protein automated matches [254699] (5 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255949] (3 PDB entries) |
![]() | Domain d3s1mf_: 3s1m F: [249267] Other proteins in same PDB: d3s1ma_, d3s1mb_, d3s1me1, d3s1me2, d3s1mh_, d3s1mi1, d3s1mi2, d3s1mj_, d3s1mk_, d3s1ml_ automated match to d1twff_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 3s1m (more details), 3.13 Å
SCOPe Domain Sequences for d3s1mf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s1mf_ a.143.1.2 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekki plvirrylpdgsfedwsveelivdl
Timeline for d3s1mf_: