Lineage for d3s1me2 (3s1m E:144-215)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958567Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 2958568Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 2958608Family d.78.1.0: automated matches [254302] (1 protein)
    not a true family
  6. 2958609Protein automated matches [254702] (3 species)
    not a true protein
  7. 2958610Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255952] (3 PDB entries)
  8. 2958613Domain d3s1me2: 3s1m E:144-215 [249266]
    Other proteins in same PDB: d3s1ma_, d3s1mb_, d3s1me1, d3s1mf_, d3s1mh_, d3s1mi1, d3s1mi2, d3s1mj_, d3s1mk_, d3s1ml_
    automated match to d1dzfa2
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s1me2

PDB Entry: 3s1m (more details), 3.13 Å

PDB Description: rna polymerase ii initiation complex with a 5-nt rna (variant 1)
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3s1me2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s1me2 d.78.1.0 (E:144-215) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d3s1me2:

Click to download the PDB-style file with coordinates for d3s1me2.
(The format of our PDB-style files is described here.)

Timeline for d3s1me2: