SCOPe 2.08: Domain d3s1me2: 3s1m E:144-215

Lineage for d3s1me2 (3s1m E:144-215)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families)
   automatically mapped to Pfam PF01191

5. Family d.78.1.0: automated matches [254302] (1 protein)
   not a true family

6. Protein automated matches [254702] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255952] (3 PDB entries)

8. Domain d3s1me2: 3s1m E:144-215 [249266]
   Other proteins in same PDB: d3s1ma_, d3s1mb_, d3s1me1, d3s1mf_, d3s1mh_, d3s1mi1, d3s1mi2, d3s1mj_, d3s1mk_, d3s1ml_
   automated match to d1dzfa2
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s1me2

PDB Entry: 3s1m, 3.13 Å

PDB Description: rna polymerase ii initiation complex with a 5-nt rna (variant 1)

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3s1me2:

Sequence; same for both SEQRES and ATOM records:

>d3s1me2 d.78.1.0 (E:144-215) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d3s1me2:

• d3s1me2 first appeared in SCOPe 2.04
  
• d3s1me2 appears in SCOPe 2.07