Lineage for d3s1mb_ (3s1m B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574252Family e.29.1.1: RNA-polymerase beta [64485] (4 proteins)
  6. 2574312Protein automated matches [190192] (4 species)
    not a true protein
  7. 2574313Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187158] (5 PDB entries)
  8. 2574318Domain d3s1mb_: 3s1m B: [249264]
    Other proteins in same PDB: d3s1ma_, d3s1me1, d3s1me2, d3s1mf_, d3s1mh_, d3s1mi1, d3s1mi2, d3s1mj_, d3s1mk_, d3s1ml_
    automated match to d1i3qb_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s1mb_

PDB Entry: 3s1m (more details), 3.13 Å

PDB Description: rna polymerase ii initiation complex with a 5-nt rna (variant 1)
PDB Compounds: (B:) DNA-directed RNA polymerase II subunit RPB2

SCOPe Domain Sequences for d3s1mb_:

Sequence, based on SEQRES records: (download)

>d3s1mb_ e.29.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rsrdf

Sequence, based on observed residues (ATOM records): (download)

>d3s1mb_ e.29.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlieisfgkiyv
tkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyeaidkvfigrlpimlrsknc
ylseatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvae
irsalekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeile
hicydvndwqmlemlkpcvedgfviqdretaldfigkekriqyakdilqkeflphitqle
gfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdi
frymqrtvelainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlr
rtntpiakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewg
mepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirek
elkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglve
yidaeeeesiliamqpedlepaeadvdpakrirvshhattfthceihpsmilgvaasiip
fpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrel
pagqnaivaiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekp
qrtntlrmkhgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivd
qvlvttnqdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdl
iinphaipsrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfe
vmynghtgkklmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrf
gemerdcmiahgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkid
iyqihipyaakllfqelmamnitprlytdrsrdf

SCOPe Domain Coordinates for d3s1mb_:

Click to download the PDB-style file with coordinates for d3s1mb_.
(The format of our PDB-style files is described here.)

Timeline for d3s1mb_: