SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3qvdc1 (3qvd C:2-134)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1989355Protein automated matches [190041] (26 species)
    not a true protein
  7. 1989922Species Pyrococcus furiosus [TaxId:2261] [232940] (4 PDB entries)
  8. 1989929Domain d3qvdc1: 3qvd C:2-134 [249005]
    Other proteins in same PDB: d3qvda2, d3qvdb2, d3qvdc2, d3qvdd2, d3qvde2, d3qvdf2, d3qvdg2, d3qvdh2
    automated match to d3mpsa1
    complexed with fe, fe2, peo

Details for d3qvdc1

PDB Entry: 3qvd (more details), 2 Å

PDB Description: Exposure of rubrerythrin from Pyrococcus furiosus to peroxide, fifteen second time point.
PDB Compounds: (C:) rubrerythrin

SCOPe Domain Sequences for d3qvdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvdc1 a.25.1.1 (C:2-134) automated matches {Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

SCOPe Domain Coordinates for d3qvdc1:

Click to download the PDB-style file with coordinates for d3qvdc1.
(The format of our PDB-style files is described here.)

Timeline for d3qvdc1: