Lineage for d3qvde1 (3qvd E:2-134)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2703138Species Pyrococcus furiosus [TaxId:2261] [232940] (4 PDB entries)
  8. 2703147Domain d3qvde1: 3qvd E:2-134 [249009]
    Other proteins in same PDB: d3qvda2, d3qvdb2, d3qvdc2, d3qvdd2, d3qvde2, d3qvdf2, d3qvdg2, d3qvdh2
    automated match to d3mpsa1
    complexed with fe, fe2, peo

Details for d3qvde1

PDB Entry: 3qvd (more details), 2 Å

PDB Description: Exposure of rubrerythrin from Pyrococcus furiosus to peroxide, fifteen second time point.
PDB Compounds: (E:) rubrerythrin

SCOPe Domain Sequences for d3qvde1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvde1 a.25.1.1 (E:2-134) automated matches {Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

SCOPe Domain Coordinates for d3qvde1:

Click to download the PDB-style file with coordinates for d3qvde1.
(The format of our PDB-style files is described here.)

Timeline for d3qvde1: