PDB entry 3qvd

View 3qvd on RCSB PDB site
Description: Exposure of rubrerythrin from Pyrococcus furiosus to peroxide, fifteen second time point.
Class: oxidoreductase
Keywords: Rubrerythrin, Peroxide reduction, removal of reactive oxygen species, oxidoreductase
Deposited on 2011-02-25, released 2011-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qvda1, d3qvda2
  • Chain 'B':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qvdb1, d3qvdb2
  • Chain 'C':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qvdc1, d3qvdc2
  • Chain 'D':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qvdd1, d3qvdd2
  • Chain 'E':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qvde1, d3qvde2
  • Chain 'F':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qvdf1, d3qvdf2
  • Chain 'G':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qvdg1, d3qvdg2
  • Chain 'H':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qvdh1, d3qvdh2
  • Heterogens: PEO, FE2, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvdA (A:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvdB (B:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvdC (C:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvdD (D:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvdE (E:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvdF (F:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvdG (G:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvdH (H:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe