Lineage for d3pena1 (3pen A:2-206)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868719Species Sulfolobus solfataricus [TaxId:2287] [255781] (6 PDB entries)
  8. 2868720Domain d3pena1: 3pen A:2-206 [248472]
    Other proteins in same PDB: d3pena2, d3pena3
    automated match to d2qn6a3
    complexed with 5gp, gdp, mg

Details for d3pena1

PDB Entry: 3pen (more details), 2.3 Å

PDB Description: Structure of archaeal initiation factor aIF2gamma subunit delta 37-47 from Sulfolobus solfataricus in the GDP-bound form.
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3pena1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pena1 c.37.1.8 (A:2-206) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskklgyaetnigvcesckkpeayvtep
sckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtreh
fvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkinid
sliegieeyiktpy

SCOPe Domain Coordinates for d3pena1:

Click to download the PDB-style file with coordinates for d3pena1.
(The format of our PDB-style files is described here.)

Timeline for d3pena1: