PDB entry 3pen

View 3pen on RCSB PDB site
Description: Structure of archaeal initiation factor aIF2gamma subunit delta 37-47 from Sulfolobus solfataricus in the GDP-bound form.
Class: RNA binding protein
Keywords: RNA, Met, Archaeal Proteins, Binding Sites, Prokaryotic Init Factor-2, Guanosine Diphosphate, RNA BINDING PROTEIN
Deposited on 2010-10-27, released 2011-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pena1, d3pena2, d3pena3
  • Heterogens: GDP, 5GP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3penA (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskklgyaetnigvcesckkpeayvtep
    sckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtreh
    fvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkinid
    sliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqe
    ikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnll
    gsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivts
    vkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei