SCOPe 2.08: Domain d3p4sc_: 3p4s C:

Lineage for d3p4sc_ (3p4s C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein automated matches [254461] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:701177] [256012] (2 PDB entries)

8. Domain d3p4sc_: 3p4s C: [248422]
   Other proteins in same PDB: d3p4sb1, d3p4sb2, d3p4sn1, d3p4sn2
   automated match to d3p4pc_
   complexed with 3np, f3s, fad, fes, sf4

Details for d3p4sc_

PDB Entry: 3p4s, 3.1 Å

PDB Description: Crystal structure of Menaquinol:fumarate oxidoreductase in complex with a 3-nitropropionate adduct

PDB Compounds: (C:) Fumarate reductase subunit C

SCOPe Domain Sequences for d3p4sc_:

Sequence; same for both SEQRES and ATOM records:

>d3p4sc_ f.21.2.2 (C:) automated matches {Escherichia coli [TaxId: 701177]}
ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw

Timeline for d3p4sc_:

• d3p4sc_ first appeared in SCOPe 2.04
  
• d3p4sc_ appears in SCOPe 2.07