Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
Protein automated matches [231466] (5 species) not a true protein |
Species Escherichia coli [TaxId:216592] [256013] (2 PDB entries) |
Domain d3p4sb1: 3p4s B:1-105 [248420] Other proteins in same PDB: d3p4sb2, d3p4sc_, d3p4sn2, d3p4so_ automated match to d3p4pb1 complexed with 3np, f3s, fad, fes, sf4 |
PDB Entry: 3p4s (more details), 3.1 Å
SCOPe Domain Sequences for d3p4sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p4sb1 d.15.4.2 (B:1-105) automated matches {Escherichia coli [TaxId: 216592]} aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd
Timeline for d3p4sb1:
View in 3D Domains from other chains: (mouse over for more information) d3p4sc_, d3p4sn1, d3p4sn2, d3p4so_ |