Lineage for d3p4sb1 (3p4s B:1-105)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934157Protein automated matches [231466] (5 species)
    not a true protein
  7. 2934189Species Escherichia coli [TaxId:216592] [256013] (2 PDB entries)
  8. 2934192Domain d3p4sb1: 3p4s B:1-105 [248420]
    Other proteins in same PDB: d3p4sb2, d3p4sc_, d3p4sn2, d3p4so_
    automated match to d3p4pb1
    complexed with 3np, f3s, fad, fes, sf4

Details for d3p4sb1

PDB Entry: 3p4s (more details), 3.1 Å

PDB Description: Crystal structure of Menaquinol:fumarate oxidoreductase in complex with a 3-nitropropionate adduct
PDB Compounds: (B:) Fumarate reductase iron-sulfur subunit

SCOPe Domain Sequences for d3p4sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p4sb1 d.15.4.2 (B:1-105) automated matches {Escherichia coli [TaxId: 216592]}
aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd

SCOPe Domain Coordinates for d3p4sb1:

Click to download the PDB-style file with coordinates for d3p4sb1.
(The format of our PDB-style files is described here.)

Timeline for d3p4sb1: