SCOPe 2.08: Domain d3p4sn2: 3p4s N:106-243

Lineage for d3p4sn2 (3p4s N:106-243)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein automated matches [231469] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:216592] [256014] (2 PDB entries)

8. Domain d3p4sn2: 3p4s N:106-243 [248424]
   Other proteins in same PDB: d3p4sb1, d3p4sc_, d3p4sn1, d3p4so_
   automated match to d3p4pb2
   complexed with 3np, f3s, fad, fes, sf4

Details for d3p4sn2

PDB Entry: 3p4s, 3.1 Å

PDB Description: Crystal structure of Menaquinol:fumarate oxidoreductase in complex with a 3-nitropropionate adduct

PDB Compounds: (N:) Fumarate reductase iron-sulfur subunit

SCOPe Domain Sequences for d3p4sn2:

Sequence; same for both SEQRES and ATOM records:

>d3p4sn2 a.1.2.1 (N:106-243) automated matches {Escherichia coli [TaxId: 216592]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

Timeline for d3p4sn2:

• d3p4sn2 first appeared in SCOPe 2.04
  
• d3p4sn2 appears in SCOPe 2.07