Lineage for d3p4sn2 (3p4s N:106-243)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2302631Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2302632Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2302692Protein automated matches [231469] (4 species)
    not a true protein
  7. 2302693Species Escherichia coli [TaxId:216592] [256014] (2 PDB entries)
  8. 2302697Domain d3p4sn2: 3p4s N:106-243 [248424]
    Other proteins in same PDB: d3p4sb1, d3p4sc_, d3p4sn1, d3p4so_
    automated match to d3p4pb2
    complexed with 3np, f3s, fad, fes, sf4

Details for d3p4sn2

PDB Entry: 3p4s (more details), 3.1 Å

PDB Description: Crystal structure of Menaquinol:fumarate oxidoreductase in complex with a 3-nitropropionate adduct
PDB Compounds: (N:) Fumarate reductase iron-sulfur subunit

SCOPe Domain Sequences for d3p4sn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p4sn2 a.1.2.1 (N:106-243) automated matches {Escherichia coli [TaxId: 216592]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOPe Domain Coordinates for d3p4sn2:

Click to download the PDB-style file with coordinates for d3p4sn2.
(The format of our PDB-style files is described here.)

Timeline for d3p4sn2: