Lineage for d3ouua3 (3ouu A:330-443)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426884Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2427009Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2427010Protein automated matches [254496] (16 species)
    not a true protein
  7. 2427016Species Campylobacter jejuni [TaxId:192222] [256008] (2 PDB entries)
  8. 2427017Domain d3ouua3: 3ouu A:330-443 [248342]
    Other proteins in same PDB: d3ouua1, d3ouua2, d3ouua4, d3ouub1, d3ouub2
    automated match to d1ulza1
    complexed with anp, ca, cac, fmt, gol

Details for d3ouua3

PDB Entry: 3ouu (more details), 2.25 Å

PDB Description: Crystal Structure of Biotin Carboxylase-beta-gamma-ATP Complex from Campylobacter jejuni
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d3ouua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ouua3 b.84.2.0 (A:330-443) automated matches {Campylobacter jejuni [TaxId: 192222]}
lnghsiecritaedsktflpspgkitkyippagrnvrmeshcyqdysvpayydsmigklv
vwaedrnkaiakmkvaldellisgikttkdfhlsmmenpdfinnnydtnylarh

SCOPe Domain Coordinates for d3ouua3:

Click to download the PDB-style file with coordinates for d3ouua3.
(The format of our PDB-style files is described here.)

Timeline for d3ouua3: